Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein UL9 (UL9)

This Recombinant Human cytomegalovirus Uncharacterized protein UL9 (UL9) spans the amino acid sequence from region 20-228.

Product Specifications

Product Name Alternative

Uncharacterized protein UL9

UniProt

P16745

Expression Region

20-228

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FYQWWKPDTTSCIQKTGYEGQNLSLPPSNALSSKDYTFSWYKDSLKALNMLCYYTEKLEE IDSKPDTIRRCFLNHTLFLINLTSHYSGIYYFDSLYTYGWVLRTPLCYNVTVYSIYQTHI HTTILLYPPTSTYNSLTISSFTSTNLTHTAVHYAAGNVEAQHDTATPHTMWIIPLVIVTT IIVLICFKFPQKAWNKFTQYRYNSMLTAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PDE10A qPCR Primer Pair
QH32541S 200 Tests

Human PDE10A qPCR Primer Pair

Sign In for Pricing
View Details
Folr2 Rat siRNA Oligo Duplex (Locus ID 293154)
SR503263 1 Kit

Folr2 Rat siRNA Oligo Duplex (Locus ID 293154)

Sign In for Pricing
View Details
Rat Zfand3 Pre-designed siRNA Set B
SI216254B 1 Each

Rat Zfand3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral human SERPINI2 shRNA (UAS) - Lentiviral human SERPINI2 shRNA (UAS) (100)
GTR15323529 1 Vial

Lentiviral human SERPINI2 shRNA (UAS) - Lentiviral human SERPINI2 shRNA (UAS) (100)

Sign In for Pricing
View Details
SEZ6L2 Antibody, Biotin Conjugated
MBS7135009-01 0.05 mL

SEZ6L2 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
SEZ6L2 Antibody, Biotin Conjugated
MBS7135009-02 0.1 mL

SEZ6L2 Antibody, Biotin Conjugated

Sign In for Pricing
View Details