Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein UL9 (UL9)

This Recombinant Human cytomegalovirus Uncharacterized protein UL9 (UL9) spans the amino acid sequence from region 20-228.

Product Specifications

Product Name Alternative

Uncharacterized protein UL9

UniProt

P16745

Expression Region

20-228

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FYQWWKPDTTSCIQKTGYEGQNLSLPPSNALSSKDYTFSWYKDSLKALNMLCYYTEKLEE IDSKPDTIRRCFLNHTLFLINLTSHYSGIYYFDSLYTYGWVLRTPLCYNVTVYSIYQTHI HTTILLYPPTSTYNSLTISSFTSTNLTHTAVHYAAGNVEAQHDTATPHTMWIIPLVIVTT IIVLICFKFPQKAWNKFTQYRYNSMLTAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H2BC Antibody, HRP conjugated
CSB-PA01694B0Rb-01 50 µg

HIST1H2BC Antibody, HRP conjugated

Sign In for Pricing
View Details
HIST1H2BC Antibody, HRP conjugated
CSB-PA01694B0Rb-02 100 µg

HIST1H2BC Antibody, HRP conjugated

Sign In for Pricing
View Details
Rat FABP5 (Fatty Acid Binding Protein 5) ELISA Kit
ER21368 96 Tests

Rat FABP5 (Fatty Acid Binding Protein 5) ELISA Kit

Sign In for Pricing
View Details
NEK6 Protein Vector (Mouse) (pPB-C-His)
PV204886 500 ng

NEK6 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
MAST4 AAV siRNA Pooled Vector
28139161 1.0 µg

MAST4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
AU*Goat Anti IgG H+L
SA0152 100 µL

AU*Goat Anti IgG H+L

Sign In for Pricing
View Details