Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dense granule protein 7 (GRA7)

This Recombinant Dense granule protein 7 (GRA7) spans the amino acid sequence from region 27-236.

Product Specifications

Product Name Alternative

Dense granule protein 7, Protein GRA 7, 29 kDa excretory dense granule protein, p29

UniProt

O00933

Expression Region

27-236

Origin

Toxoplasma gondii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATASDDELMSRIRNSDFFDGQAPVDSLRPTNAGVDSKGTDDHLTTSMDKASVESQLPRRE PLETEPDEQEEVHFRKRGVRSDAEVTDDNIYEEHTDRKVVPRKSEGKRSFKDLLKKLALP AVGMGASYFAADRLVPELTEEQQRGDEPLTTGQNVGTVLGFAALAAAAAFLGMGLTRTYR HFSPRKNRSRQPALEQEVPESGEDGEDARQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Imrecoxib Impurity 1
RM-I600001-01 10 mg

Imrecoxib Impurity 1

Sign In for Pricing
View Details
Imrecoxib Impurity 1
RM-I600001-02 25 mg

Imrecoxib Impurity 1

Sign In for Pricing
View Details
Imrecoxib Impurity 1
RM-I600001-03 50 mg

Imrecoxib Impurity 1

Sign In for Pricing
View Details
Imrecoxib Impurity 1
RM-I600001-04 100 mg

Imrecoxib Impurity 1

Sign In for Pricing
View Details
O-(2-Ethylbutyl) Dabigatran Ethyl Ester
TRC-E900655-100MG 100 mg

O-(2-Ethylbutyl) Dabigatran Ethyl Ester

Sign In for Pricing
View Details
5-Fluoro-3,4-dihydroquinolin-2 (1H) -one
PC1006026-01 250 mg

5-Fluoro-3,4-dihydroquinolin-2 (1H) -one

Sign In for Pricing
View Details