Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dense granule protein 7 (GRA7)

This Recombinant Dense granule protein 7 (GRA7) spans the amino acid sequence from region 27-236.

Product Specifications

Product Name Alternative

Dense granule protein 7, Protein GRA 7, 29 kDa excretory dense granule protein, p29

UniProt

O00933

Expression Region

27-236

Origin

Toxoplasma gondii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATASDDELMSRIRNSDFFDGQAPVDSLRPTNAGVDSKGTDDHLTTSMDKASVESQLPRRE PLETEPDEQEEVHFRKRGVRSDAEVTDDNIYEEHTDRKVVPRKSEGKRSFKDLLKKLALP AVGMGASYFAADRLVPELTEEQQRGDEPLTTGQNVGTVLGFAALAAAAAFLGMGLTRTYR HFSPRKNRSRQPALEQEVPESGEDGEDARQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RARG Protein, N-His
YHC98901 100 μg

Recombinant Human RARG Protein, N-His

Sign In for Pricing
View Details
TRIM25 Over-expression Lysate Product
GWB-B02EB5 0.1 mg

TRIM25 Over-expression Lysate Product

Sign In for Pricing
View Details
ELF4 (ETS-related Transcription Factor Elf-4, E74-like Factor 4, Myeloid Elf-1-like Factor, MEF, ELFR) (PE)
126279-PE 100 µL

ELF4 (ETS-related Transcription Factor Elf-4, E74-like Factor 4, Myeloid Elf-1-like Factor, MEF, ELFR) (PE)

Sign In for Pricing
View Details
RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (AP)
MBS6163631-01 0.1 mL

RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (AP)

Sign In for Pricing
View Details
RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (AP)
MBS6163631-02 5x 0.1 mL

RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (AP)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Fas Associating Death Domain Containing Protein (FADD)
MBS2081987-01 0.1 mL

FITC-Linked Polyclonal Antibody to Fas Associating Death Domain Containing Protein (FADD)

Sign In for Pricing
View Details