Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Coccidioides immitis Protein GET1 (GET1)

This Recombinant Coccidioides immitis Protein GET1 (GET1) spans the amino acid sequence from region 1-210.

Product Specifications

Product Name Alternative

Protein GET1, Guided entry of tail-anchored proteins 1

UniProt

Q1DZS0

Expression Region

1-210

Origin

Coccidioides immitis (strain RS) (Valley fever fungus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSLLIIVLIIHVVTYLINTIGANTIDSLLWLLYLKLPNQTSQTANEQRRLKREVMQLKR EMNATSSQDEFAKWAKLRRRHDKTMEEYEAKNKALGKHKSSFDLAVKSIRFFSTTGLKLF LQFWCSKTPIFELPRGWIPWQVEWVLSFPRAPLGTVSIQIWGGVCATVVSLAGDAIGVVN VYLTSKAPKQKEPATSGENSARPMAIKKEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Anti-Human CD147 Antibody[HIM6]
E-AB-F1056M-01 20 Tests

Elab Fluor® 647 Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD147 Antibody[HIM6]
E-AB-F1056M-02 100 Tests

Elab Fluor® 647 Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD147 Antibody[HIM6]
E-AB-F1056M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD147 Antibody[HIM6]

Sign In for Pricing
View Details
Frozen Tissue Sections, Salivary gland
CS649413 5x 5 µm

Frozen Tissue Sections, Salivary gland

Sign In for Pricing
View Details
Fluoxastrobin-d4
TRC-F596702-2.5MG 2.5 mg

Fluoxastrobin-d4

Sign In for Pricing
View Details
RAC1 (NM_006908) Human Recombinant Protein
TP308711M 100 µg

RAC1 (NM_006908) Human Recombinant Protein

Sign In for Pricing
View Details