Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea Chlorophyll a-b binding protein CP24, chloroplastic

This Recombinant Spinacia oleracea Chlorophyll a-b binding protein CP24, chloroplastic spans the amino acid sequence from region 52-261.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein CP24, chloroplastic

UniProt

P36494

Expression Region

52-261

Origin

Spinacia oleracea (Spinach)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAAPKKSWIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRW AMLAVLGIFVGQAWTGIPWFEAGADPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFDPD SQSVEWATPWSRTAENFSNSTGEQGYPGGKFFDPLSLAGTISNGVYNPDTDKLERLKLAE IKHARLAMLAMLIFYFEAGQGKTPLGALGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (T-Cell Marker) (rC3e/1931), CF640R conjugate, 0.1mg/mL
BNC403644-100 1x 100 µL

CD3e (T-Cell Marker) (rC3e/1931), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GABRB1 Rabbit Polyclonal Antibody
ER1901-66 100 µL

GABRB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cend1 Mouse Gene Knockout Kit (CRISPR)
KN503123 1 Kit

Cend1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(R)-a-Phellandrene
TRC-P294570-2.5ML 2.5 mL

(R)-a-Phellandrene

Sign In for Pricing
View Details
Mouse Chm activation kit by CRISPRa
GA200721 1 Kit

Mouse Chm activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse Butyrophilin 1A1/BTN1A1 Protein (His Tag)
PKSM040968-01 10 µg

Recombinant Mouse Butyrophilin 1A1/BTN1A1 Protein (His Tag)

Sign In for Pricing
View Details