Recombinant Solanum lycopersicum Chlorophyll a-b binding protein CP24 10B, chloroplastic (CAP10B)
This Recombinant Solanum lycopersicum Chlorophyll a-b binding protein CP24 10B, chloroplastic (CAP10B) spans the amino acid sequence from region 46-256.
Product Specifications
Product Name Alternative
Chlorophyll a-b binding protein CP24 10B, chloroplastic, CAB-10B, LHCP
UniProt
P27525
Expression Region
46-256
Origin
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
AAAVAPKKSWIPAVKSGGNLVDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGR WAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDN DSQSIDWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLERLKLA EIKHSRLAMLAMLIFYFEAGQGKTPLGALGL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881131-500 1x 500 µL
CD45RA (PTPRC/1131), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400376-100 1x 100 µL
Beta Catenin (p120) (Rabbit PAb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details