Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein CP24 10B, chloroplastic (CAP10B)

This Recombinant Solanum lycopersicum Chlorophyll a-b binding protein CP24 10B, chloroplastic (CAP10B) spans the amino acid sequence from region 46-256.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein CP24 10B, chloroplastic, CAB-10B, LHCP

UniProt

P27525

Expression Region

46-256

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAVAPKKSWIPAVKSGGNLVDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGR WAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDN DSQSIDWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTLNNGVYVPDTEKLERLKLA EIKHSRLAMLAMLIFYFEAGQGKTPLGALGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Orexin B ELISA Kit
MBS741164-01 48 Well

Canine Orexin B ELISA Kit

Sign In for Pricing
View Details
Canine Orexin B ELISA Kit
MBS741164-02 96 Well

Canine Orexin B ELISA Kit

Sign In for Pricing
View Details
Canine Orexin B ELISA Kit
MBS741164-03 5x 96 Well

Canine Orexin B ELISA Kit

Sign In for Pricing
View Details
Canine Orexin B ELISA Kit
MBS741164-04 10x 96 Well

Canine Orexin B ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Aromatase Protein - (Dry Ice)
H00001588-P01-10ug 10 µg

Recombinant Human Aromatase Protein - (Dry Ice)

Sign In for Pricing
View Details
Gm10147 sgRNA CRISPR Lentivector set (Mouse)
K3167801 3x 1.0 µg

Gm10147 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details