Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas mendocina Electron transport complex protein RnfG (rnfG)

This Recombinant Pseudomonas mendocina Electron transport complex protein RnfG (rnfG) spans the amino acid sequence from region 1-211.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfG

UniProt

A4XS49

Expression Region

1-211

Origin

Pseudomonas mendocina (strain ymp)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPEISRSMLKNALVLGLFAIGTVGSVALLQQGTATRIAAAEREAQVRALAEILPAGSYD NHLLDNRIELNAPELGHRSPQSAYLALKGEQPSALILPVTAPDGYSGAIHLLVGIFADGR LAGVRVLGHRETPGLGDKIELAKSDWIRSFEGKSLSDPNEDGWAVKKDRGEFDQFAGATI TPRAVVKAVHGALRYFDKHRAQLLGLAEDEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSAT1 (1-370, His-tag) Human Protein
AR50153PU-N 500 µg

PSAT1 (1-370, His-tag) Human Protein

Sign In for Pricing
View Details
ELMO1 Antibody
MBS7134187-01 0.05 mL

ELMO1 Antibody

Sign In for Pricing
View Details
ELMO1 Antibody
MBS7134187-02 0.1 mL

ELMO1 Antibody

Sign In for Pricing
View Details
ELMO1 Antibody
MBS7134187-03 5x 0.1 mL

ELMO1 Antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Immunoglobulin G (IgG)
MBS2169673-01 0.1 mL

Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
Monoclonal Antibody to Immunoglobulin G (IgG)
MBS2169673-02 0.2 mL

Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details