Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis NEDD4 family-interacting protein 1 (ndfip1)

This Recombinant Xenopus tropicalis NEDD4 family-interacting protein 1 (ndfip1) spans the amino acid sequence from region 1-211.

Product Specifications

Product Name Alternative

NEDD4 family-interacting protein 1

UniProt

Q4V786

Expression Region

1-211

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEQSSSRYQQLQNEEEPGENPQASTDAPPPYSSIAGESSGLFDYKDELGFPKPPSYNVA TSLPSYDEAERTKAEATIPLVPGRDDDFVARDDFDDADQLRIGNDGIFMLTFFMAFLFNW IGFFLSFCLTSSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFL LFLRGFINYAKVRKMPDNFSTLPRTRVLFIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-500 1x 500 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-500 1x 500 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-500 1x 500 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-100 1x 100 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Luteinizing Hormone beta (LH beta) (LHb/1214), CF740 conjugate, 0.1mg/mL
BNC741214-500 1x 500 µL

Luteinizing Hormone beta (LH beta) (LHb/1214), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details