What sizes are available for Recombinant Mouse Peroxisomal membrane protein 4 (Pxmp4)?

Recombinant Mouse Peroxisomal membrane protein 4 (Pxmp4) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Mouse Peroxisomal membrane protein 4 (Pxmp4) come in?

Recombinant Mouse Peroxisomal membrane protein 4 (Pxmp4) is available in 2 different pack sizes.

Recombinant Mouse Peroxisomal membrane protein 4 (Pxmp4)

Q: What is the catalog number for Recombinant Mouse Peroxisomal membrane protein 4 (Pxmp4)?

The catalog number for Recombinant Mouse Peroxisomal membrane protein 4 (Pxmp4) is orb2929105.

This Recombinant Mouse Peroxisomal membrane protein 4 (Pxmp4) spans the amino acid sequence from region 2-212.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 4, 24 kDa peroxisomal intrinsic membrane protein

UniProt

Q9JJW0

Expression Region

2-212

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAPPQLQALLQAVNKLLRQRRYHAALAVIKGFRNGAVYGVKIRAPHALVMTFLFRSGSLR EKLQAILKATYIHSRNLACFVFAYKSLHALQSHVQGETHQMHSFLAAFIGGLLLFGENNN INSQINMYLTSRVLYALCRLGVEKGYIPALKWDPFPLHTAVIWGLVLWLFEYHRPTLQPS LQSSMTYLYEDSNVWHDLSDFLIFNKSHPSK