Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma genitalium Uncharacterized protein MG331 (MG331)

This Recombinant Mycoplasma genitalium Uncharacterized protein MG331 (MG331) spans the amino acid sequence from region 1-212.

Product Specifications

Product Name Alternative

Uncharacterized protein MG331

UniProt

P47573

Expression Region

1-212

Origin

Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRVEKFRFYRQSFDNNKIVKKALINAQKNTESWKKQLNKINQKILINYHPFSEFNKNPV KHHTEPNKLFKTLQELIVDLKNTDFKLLEEKVDRMWLNAAYNQTSSGYESWISDDKGIEK INHLSKFYEANEKQWLKKTSNLTSDLKEYNKILTVFSTESFAFKKSIDNIEPNLFNANKA IFKNLVITLISFMLFSILFFLIFLIVSFVSFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iron(II) Phthalocyanine
TRC-I775260-250MG 250 mg

Iron(II) Phthalocyanine

Sign In for Pricing
View Details
APC / Adenomatous Polyposis Coli / FAP (Tumor Suppressor) (ALi 12-28), CF405S conjugate, 0.1mg/mL
BNC043076-100 1x 100 µL

APC / Adenomatous Polyposis Coli / FAP (Tumor Suppressor) (ALi 12-28), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SH2D1B Antibody
8C18698-AAT 50 µg

SH2D1B Antibody

Sign In for Pricing
View Details
10-Ketonalmefene
TRC-K388380-10MG 10 mg

10-Ketonalmefene

Sign In for Pricing
View Details
Retinal S antigen (SAG) (NM_000541) Human Recombinant Protein
TP320057L 1 mg

Retinal S antigen (SAG) (NM_000541) Human Recombinant Protein

Sign In for Pricing
View Details
Proteasome 20S beta 7 (PSMB7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E1]
TA504368BM 100 µL

Proteasome 20S beta 7 (PSMB7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E1]

Sign In for Pricing
View Details