Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma genitalium Uncharacterized protein MG331 (MG331)

This Recombinant Mycoplasma genitalium Uncharacterized protein MG331 (MG331) spans the amino acid sequence from region 1-212.

Product Specifications

Product Name Alternative

Uncharacterized protein MG331

UniProt

P47573

Expression Region

1-212

Origin

Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRVEKFRFYRQSFDNNKIVKKALINAQKNTESWKKQLNKINQKILINYHPFSEFNKNPV KHHTEPNKLFKTLQELIVDLKNTDFKLLEEKVDRMWLNAAYNQTSSGYESWISDDKGIEK INHLSKFYEANEKQWLKKTSNLTSDLKEYNKILTVFSTESFAFKKSIDNIEPNLFNANKA IFKNLVITLISFMLFSILFFLIFLIVSFVSFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXB1 (NM_012182) Human Recombinant Protein
TP314562 20 µg

FOXB1 (NM_012182) Human Recombinant Protein

Sign In for Pricing
View Details
CD71 (TFRC) Human Gene Knockout Kit (CRISPR)
KN400980 1 Kit

CD71 (TFRC) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 7/17 (C-46), Biotin conjugate, 0.1mg/mL
BNCB0949-100 1x 100 µL

Cytokeratin 7/17 (C-46), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLCNE (GNE) Human Gene Knockout Kit (CRISPR)
KN422626 1 Kit

GLCNE (GNE) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RGS3 (NM_134427) Human Recombinant Protein
TP306471 20 µg

RGS3 (NM_134427) Human Recombinant Protein

Sign In for Pricing
View Details
Dulcitol Diepoxide
TRC-D720515-100MG 100 mg

Dulcitol Diepoxide

Sign In for Pricing
View Details