Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized membrane protein C3orf80 (C3orf80)

This Recombinant Human Uncharacterized membrane protein C3orf80 (C3orf80) spans the amino acid sequence from region 36-247.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein C3orf80

UniProt

F5H4A9

Expression Region

36-247

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RGGGGCAELACGERERCCDATNATAVRCCKLPLHAFLDNVGWFVRKLSGLLILLVLFAIG YFLQRIICPSPRRYPRGQARPGQRPGPPGGAGPLGGAGPPDDDDDSPALLRDEAAAGSQD SLLDSGGGGRGRGGGGRSDPSCASEHEMRVVSPVFLQLPSYEEVKYLPTYEESMRLQQLS PGEVVLPVSVLGRPRGGVAAEPDGGEGRYPLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG5 (Autophagy Marker) (ATG5/2492), CF647 conjugate, 0.1mg/mL
BNC472492-500 1x 500 µL

ATG5 (Autophagy Marker) (ATG5/2492), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SQSTM1 Antibody
RC-3039-01 50 μL

Recombinant SQSTM1 Antibody

Sign In for Pricing
View Details
Recombinant SQSTM1 Antibody
RC-3039-02 100 µL

Recombinant SQSTM1 Antibody

Sign In for Pricing
View Details
Recombinant SQSTM1 Antibody
RC-3039-03 1 mL

Recombinant SQSTM1 Antibody

Sign In for Pricing
View Details
myosin light chain 1 (MYL1) Mouse Monoclonal Antibody [Clone ID: OTI2E11]
CF810647 100 µg

myosin light chain 1 (MYL1) Mouse Monoclonal Antibody [Clone ID: OTI2E11]

Sign In for Pricing
View Details
PEX5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G8]
TA501406BM 100 µL

PEX5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G8]

Sign In for Pricing
View Details