Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B)

This Recombinant Human Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B) spans the amino acid sequence from region 43-254.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 90B, mitochondrial

UniProt

Q9GZT6

Expression Region

43-254

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GYDRRPVDITPLEQRKLTFDTHALVQDLETHGFDKTQAETIVSALTALSNVSLDTIYKEM VTQAQQEITVQQLMAHLDAIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRI RADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKT LMESNKLETIRYLAASVFTCLAIALGFYRFWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RA (PTPRC/818), CF740 conjugate, 0.1mg/mL
BNC740818-100 1x 100 µL

CD45RA (PTPRC/818), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pigment Orange 13 (Technical Grade)
TRC-P437813-50G 50 g

Pigment Orange 13 (Technical Grade)

Sign In for Pricing
View Details
Microphthalmia Transcription Factor (MITF) (MITF/2987R), CF405S conjugate, 0.1mg/mL
BNC042987-500 1x 500 µL

Microphthalmia Transcription Factor (MITF) (MITF/2987R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1 (CD1A) Human Gene Knockout Kit (CRISPR)
KN421599 1 Kit

CD1 (CD1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse Ccl21a Protein (Trx Tag)
PDEM100119-01 20 µg

Recombinant Mouse Ccl21a Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ccl21a Protein (Trx Tag)
PDEM100119-02 100 µg

Recombinant Mouse Ccl21a Protein (Trx Tag)

Sign In for Pricing
View Details