Recombinant Phaeosphaeria nodorum Protein GET1 (GET1)
This Recombinant Phaeosphaeria nodorum Protein GET1 (GET1) spans the amino acid sequence from region 1-213.
Product Specifications
Product Name Alternative
Protein GET1, Guided entry of tail-anchored proteins 1
UniProt
Q0UTI3
Expression Region
1-213
Origin
Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Septoria nodorum)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPSLLLVVFILQFLLHIINTVGASTVNDLLWILYNKLPTPTSSSAQKAQKLKKEIVQLKR ELGATSAQDNFSKWAKLDRQHNKAMAEFQKIDGSLRGHQTAFTSAVSTLRWLGTQGLRFV LQFWFAKSPMFWMPAGWLPFYVEWILSFPRAPLGSVSINVWGIACASMIALAAEGLAAVW VLATKRPTPIATEKKEAMAFAADQKSSGEKKEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
G1015-06K-ML490 100 µL
GABA Receptor A, alpha 1 (Gamma-aminobutyric Acid Receptor Type A alpha 1 Subunit, Gamma-aminobutyric Acid (GABA) A Receptor alpha 1, GABA A Receptor alpha 1, GABA (A) Receptor Subunit alpha-1, GABRA1, Gabra-1) (MaxLight 490) discontinued
Sign In for Pricing
View Details 
MBS6358908-01 0.1 mL
TRPV4, NT (TRPV4, VRL2, VROAC, Transient receptor potential cation channel subfamily V member 4, Osm-9-like TRP channel 4, Transient receptor potential protein 12, Vanilloid receptor-like channel 2, Vanilloid receptor-like protein 2, Vanilloid receptor-re
Sign In for Pricing
View Details MBS6358908-02 5x 0.1 mL
TRPV4, NT (TRPV4, VRL2, VROAC, Transient receptor potential cation channel subfamily V member 4, Osm-9-like TRP channel 4, Transient receptor potential protein 12, Vanilloid receptor-like channel 2, Vanilloid receptor-like protein 2, Vanilloid receptor-re
Sign In for Pricing
View Details 