Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens ATP synthase subunit b/b' (atpG)

This Recombinant Agrobacterium tumefaciens ATP synthase subunit b/b' (atpG) spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

ATP synthase subunit b/b', ATP synthase F (0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b'

UniProt

Q7D0U9

Expression Region

1-213

Origin

Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVTEAYAQSAPTVGETHTETPAVGQPQPEATHTETGVAHGAEHGASGVFPPFDQSTYAS QVLWLAITFGLFYLLMQKVIVPRVGGILENRHGRIAQDLDEAARLKAEADTAVETYEKEL AAARAKASSIGASARDAAKAKADADRAAIEAGLAEKLAAAEKRIAGIRDHAFADVGAIAE ETATAIVDQLVGAKVKDTDVKAAIAAASAVKGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dibutyl sebacate
S6041-25ul 25 µL

Dibutyl sebacate

Sign In for Pricing
View Details
GPR52 peptide
orb218241-01 1 mg

GPR52 peptide

Sign In for Pricing
View Details
GPR52 peptide
orb218241-02 5 mg

GPR52 peptide

Sign In for Pricing
View Details
KRT1 Polyclonal Antibody
29792-01 50 µL

KRT1 Polyclonal Antibody

Sign In for Pricing
View Details
KRT1 Polyclonal Antibody
29792-02 100 µL

KRT1 Polyclonal Antibody

Sign In for Pricing
View Details
PPIC Recombinant Protein (Mouse)
RP163727 100 µg

PPIC Recombinant Protein (Mouse)

Sign In for Pricing
View Details