Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens ATP synthase subunit b/b' (atpG)

This Recombinant Agrobacterium tumefaciens ATP synthase subunit b/b' (atpG) spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

ATP synthase subunit b/b', ATP synthase F (0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b'

UniProt

Q7D0U9

Expression Region

1-213

Origin

Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFVTEAYAQSAPTVGETHTETPAVGQPQPEATHTETGVAHGAEHGASGVFPPFDQSTYAS QVLWLAITFGLFYLLMQKVIVPRVGGILENRHGRIAQDLDEAARLKAEADTAVETYEKEL AAARAKASSIGASARDAAKAKADADRAAIEAGLAEKLAAAEKRIAGIRDHAFADVGAIAE ETATAIVDQLVGAKVKDTDVKAAIAAASAVKGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cortactin (pY421) Blocking Peptide
abx062106-01 1 mg

Cortactin (pY421) Blocking Peptide

Sign In for Pricing
View Details
Cortactin (pY421) Blocking Peptide
abx062106-02 5 mg

Cortactin (pY421) Blocking Peptide

Sign In for Pricing
View Details
Recombinant Dog Oligosaccharyltransferase complex subunit OSTC (OSTC), partial
MBS7112189 Inquire

Recombinant Dog Oligosaccharyltransferase complex subunit OSTC (OSTC), partial

Sign In for Pricing
View Details
ALDH5A1 (NM_170740) Human Over-expression Lysate
LY406860 100 µg

ALDH5A1 (NM_170740) Human Over-expression Lysate

Sign In for Pricing
View Details
Silver Oxide extrapure AR, 99%
76610-01 10 g

Silver Oxide extrapure AR, 99%

Sign In for Pricing
View Details
Silver Oxide extrapure AR, 99%
76610-02 25 g

Silver Oxide extrapure AR, 99%

Sign In for Pricing
View Details