Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oenothera parviflora Chloroplast envelope membrane protein (cemA)

This Recombinant Oenothera parviflora Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

B0Z5E0

Expression Region

1-214

Origin

Oenothera parviflora (Small-flowered evening primrose) (Oenothera cruciata)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVFFPWWISLLFNKGLESWVTNWWNTTHSETFLTDMQEKSILDKFIELEELLLLDEMINE YPETHLQTLRIGIHKEMVRLIKMRNEDHIHTILHLSTNIICFIIFRGYSILGNKELLILN SWMQEFLYNLSDTIKAFSILLLTDFCIGFHSPHGWELMIAYVYKDFGFAQNDQIISGLVS TFPVILDTIFKYWIFRYLNRVSPSLVVIYDSMND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-500 1x 500 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (BCL2/796), CF640R conjugate, 0.1mg/mL
BNC400796-500 1x 500 µL

Bcl-2 (BCL2/796), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details