Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Reticulon-3-A (rtn3-a)

This Recombinant Xenopus laevis Reticulon-3-A (rtn3-a) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

Reticulon-3-A, RTN3.1

UniProt

Q5J6M8

Expression Region

1-214

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAETSGPQSSHISSSSVGEKGSGCAVRDLLYWRDVKQSGMVFGGTMVLLLSLAAFSIISV ISYLVLSLLTVTISYRVYKSVLQAVQKTDEGHPFKPLLEKDITLSSDSFQKALTASLAHV NHALKYIVRLFLVDDLVDSLKLALLMWLMTYVGAVFNGITLLILGVLLTFTAPIVYEKYK VQIDHYVSLVHSQVKSITEKIQAKLPGALKKKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNT3 Antibody
KC-3322-01 50 μL

GALNT3 Antibody

Sign In for Pricing
View Details
GALNT3 Antibody
KC-3322-02 100 µL

GALNT3 Antibody

Sign In for Pricing
View Details
GALNT3 Antibody
KC-3322-03 1 mL

GALNT3 Antibody

Sign In for Pricing
View Details
Recombinant Human CLK3 Protein (GST Tag)
PKSH031459 50 µg

Recombinant Human CLK3 Protein (GST Tag)

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF488A conjugate, 0.1mg/mL
BNC882054-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyanine 647 Succinimidyl Ester
#90025-10mg 1x 10 mg

Cyanine 647 Succinimidyl Ester

Sign In for Pricing
View Details