Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Reticulon-3-A (rtn3-a)

This Recombinant Xenopus laevis Reticulon-3-A (rtn3-a) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

Reticulon-3-A, RTN3.1

UniProt

Q5J6M8

Expression Region

1-214

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAETSGPQSSHISSSSVGEKGSGCAVRDLLYWRDVKQSGMVFGGTMVLLLSLAAFSIISV ISYLVLSLLTVTISYRVYKSVLQAVQKTDEGHPFKPLLEKDITLSSDSFQKALTASLAHV NHALKYIVRLFLVDDLVDSLKLALLMWLMTYVGAVFNGITLLILGVLLTFTAPIVYEKYK VQIDHYVSLVHSQVKSITEKIQAKLPGALKKKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diclofenac amide
FD21710-01 5 g

Diclofenac amide

Sign In for Pricing
View Details
Diclofenac amide
FD21710-02 10 g

Diclofenac amide

Sign In for Pricing
View Details
DEF6 Polyclonal Antibody
orb616167-01 50 μL

DEF6 Polyclonal Antibody

Sign In for Pricing
View Details
DEF6 Polyclonal Antibody
orb616167-02 100 µL

DEF6 Polyclonal Antibody

Sign In for Pricing
View Details
FAM108A1 ORF Vector (Human) (pORF)
19696011 1.0 µg DNA

FAM108A1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Pon1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
37227116 3x 1.0 µg

Pon1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details