Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1141 (MJ1141)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1141 (MJ1141) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1141

UniProt

Q58541

Expression Region

1-214

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISILGLDGFLQLVGMITIAIFALAFISFILILIISYILLKKNKLIFPSLALFLMDNLYS ILLKIFLLIGTEDTFYRVGIEFYNKYYEDRFKKAKKRVLILPHCLRDTKCPAKLTPKGVE CIFCNRCRVGEIIKVAEEKGYKVYIVPGSTFLKRILKEEKPEAVFGVACNRDLFYGMNML SRKGIPSQGQPLLRDGCINTLVDVDELITRLKSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAA25 CRISPR Activation Plasmid (m2)
sc-433097-ACT-2 20 µg

NAA25 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Mouse Klk1b8 qPCR Primer Pair
QM15918S 200 Tests

Mouse Klk1b8 qPCR Primer Pair

Sign In for Pricing
View Details
WAVE 1 (WASF1) CytoSection
TS408463P5 25 Slides

WAVE 1 (WASF1) CytoSection

Sign In for Pricing
View Details
Mouse Tubulin beta2A Chain ELISA Kit
MBS7256415-01 48 Well

Mouse Tubulin beta2A Chain ELISA Kit

Sign In for Pricing
View Details
Mouse Tubulin beta2A Chain ELISA Kit
MBS7256415-02 96 Well

Mouse Tubulin beta2A Chain ELISA Kit

Sign In for Pricing
View Details
Mouse Tubulin beta2A Chain ELISA Kit
MBS7256415-03 5x 96 Well

Mouse Tubulin beta2A Chain ELISA Kit

Sign In for Pricing
View Details