What is the catalog number for Recombinant Neurospora crassa Protein get-1 (get-1)?

The catalog number for Recombinant Neurospora crassa Protein get-1 (get-1) is orb2929041.

What sizes are available for Recombinant Neurospora crassa Protein get-1 (get-1)?

Recombinant Neurospora crassa Protein get-1 (get-1) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Neurospora crassa Protein get-1 (get-1) come in?

Recombinant Neurospora crassa Protein get-1 (get-1) is available in 2 different pack sizes.

Is Recombinant Neurospora crassa Protein get-1 (get-1) in stock?

Recombinant Neurospora crassa Protein get-1 (get-1) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Neurospora crassa Protein get-1 (get-1)

This Recombinant Neurospora crassa Protein get-1 (get-1) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

Protein get-1, Guided entry of tail-anchored proteins 1

UniProt

Q7S0A1

Expression Region

1-214

Origin

Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSLLVVIFVIELFVQLVNTIGAATINNLLWRIALSLPLPLSAQFAAQRKKQKEYLAIRR ELNATSSQDEFAKWARLRRQHDKLLEDLEKRKKELDAAKTKFDRTLTTVRVVATRGLQWF LPFWYSREPMFWLPYGWFPYYVEWFASFPRAPLGSVSIVVWQWACTGVIKLVIETVMAVV GLIVAARQKQQEKQKAKQAVPAAGGGDSKAEEAK