Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Coiled-coil domain-containing protein 90B, mitochondrial (Ccdc90b)

This Recombinant Mouse Coiled-coil domain-containing protein 90B, mitochondrial (Ccdc90b) spans the amino acid sequence from region 43-256.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 90B, mitochondrial

UniProt

Q8C3X2

Expression Region

43-256

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DYDRRPVDITPLEQRKLTFDTHALVQDLETHGFDKTQAQTIVSVLSTLSNVSLDTIYKEM VTKAQQEITVQQLMAHLDSIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLTNETSRI RADNKLDINLERSRVTDMFTDQEKQLIEATNEFAKKDTQTKSIISETSNKIDTEIASLKT LMESSKLETIRYLAASVFTCLAIALGFYRFWKEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometriotic tissue
CS701926 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
Tas2r107 Mouse Gene Knockout Kit (CRISPR)
KN517194 1 Kit

Tas2r107 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD79a (JCB117), CF594 conjugate, 0.1mg/mL
BNC940476-100 1x 100 µL

CD79a (JCB117), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mabuterol Hydrochloride
TRC-M104010-2.5MG 2.5 mg

Mabuterol Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS625161 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
L-Arginine
TRC-A769505-25G 25 g

L-Arginine

Sign In for Pricing
View Details