Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Coiled-coil domain-containing protein 90B, mitochondrial (Ccdc90b)

This Recombinant Mouse Coiled-coil domain-containing protein 90B, mitochondrial (Ccdc90b) spans the amino acid sequence from region 43-256.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 90B, mitochondrial

UniProt

Q8C3X2

Expression Region

43-256

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DYDRRPVDITPLEQRKLTFDTHALVQDLETHGFDKTQAQTIVSVLSTLSNVSLDTIYKEM VTKAQQEITVQQLMAHLDSIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLTNETSRI RADNKLDINLERSRVTDMFTDQEKQLIEATNEFAKKDTQTKSIISETSNKIDTEIASLKT LMESSKLETIRYLAASVFTCLAIALGFYRFWKEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (MME) (NM_000902) Human Recombinant Protein
TP323013 20 µg

CD10 (MME) (NM_000902) Human Recombinant Protein

Sign In for Pricing
View Details
Hba-a1 (NM_008218) Mouse Over-expression Lysate
LY700921 100 µg

Hba-a1 (NM_008218) Mouse Over-expression Lysate

Sign In for Pricing
View Details
GAPDH Antibody
KC-2172-01 50 μL

GAPDH Antibody

Sign In for Pricing
View Details
GAPDH Antibody
KC-2172-02 100 µL

GAPDH Antibody

Sign In for Pricing
View Details
GAPDH Antibody
KC-2172-03 1 mL

GAPDH Antibody

Sign In for Pricing
View Details
Pejvakin (DFNB59) (NM_001042702) Human Over-expression Lysate
LC421031 20 µg

Pejvakin (DFNB59) (NM_001042702) Human Over-expression Lysate

Sign In for Pricing
View Details