Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis Alkaline phosphatase-like protein (apl)

This Recombinant Lactococcus lactis subsp. lactis Alkaline phosphatase-like protein (apl) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

Alkaline phosphatase-like protein

UniProt

Q9CHL6

Expression Region

1-214

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQEIIIQVMNQFGYFGVAFLIMIENIFPPIPSEVILTFGGFMTTYSELGIIGMIIAATIG SVLGALILYFVGRLLSVERLEKLVSGRLGKVLRLKPEDITKAEKWFLKRGYATIFFCRFI PLIRSLISIPAGSAKMKLPSFLILTTLGTLIWNIVLVCLGAALGDNWEMIAGILDSYSSV VVVILGIIFILAILIFVKKRFFPKNKNYSSDTEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wfdc2 ORF Vector (Rat) (pORF)
50406016 1.0 µg DNA

Wfdc2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
1-Bromo-3-fluoro-2- (propan-2-yloxy) benzene
PC1022835 1 Each

1-Bromo-3-fluoro-2- (propan-2-yloxy) benzene

Sign In for Pricing
View Details
Mkrn2 Mouse Pre-designed siRNA Set A
HY-RS22641 1 Set

Mkrn2 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Sheep Leucine ELISA kit
GTR10452936 96 Well

Sheep Leucine ELISA kit

Sign In for Pricing
View Details
Monkey Cytochrome c oxidase subunit 7A2, mitochondrial (COX7A2) ELISA Kit
MBS7231001-01 48 Well

Monkey Cytochrome c oxidase subunit 7A2, mitochondrial (COX7A2) ELISA Kit

Sign In for Pricing
View Details
Monkey Cytochrome c oxidase subunit 7A2, mitochondrial (COX7A2) ELISA Kit
MBS7231001-02 96 Well

Monkey Cytochrome c oxidase subunit 7A2, mitochondrial (COX7A2) ELISA Kit

Sign In for Pricing
View Details