Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis Alkaline phosphatase-like protein (apl)

This Recombinant Lactococcus lactis subsp. lactis Alkaline phosphatase-like protein (apl) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

Alkaline phosphatase-like protein

UniProt

Q9CHL6

Expression Region

1-214

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQEIIIQVMNQFGYFGVAFLIMIENIFPPIPSEVILTFGGFMTTYSELGIIGMIIAATIG SVLGALILYFVGRLLSVERLEKLVSGRLGKVLRLKPEDITKAEKWFLKRGYATIFFCRFI PLIRSLISIPAGSAKMKLPSFLILTTLGTLIWNIVLVCLGAALGDNWEMIAGILDSYSSV VVVILGIIFILAILIFVKKRFFPKNKNYSSDTEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PJA2 Protein Lysate (Rat) with C-HA Tag
36860036 100 µg

PJA2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Growth Regulated Oncogene alpha (GROa) Rabbit ELISA Kit
D8446 96 Tests

Growth Regulated Oncogene alpha (GROa) Rabbit ELISA Kit

Sign In for Pricing
View Details
Nr4a3 (NM_015743) Mouse Recombinant Protein
TP525559 20 µg

Nr4a3 (NM_015743) Mouse Recombinant Protein

Sign In for Pricing
View Details
Human Sirtuin 5 (SIRT5) ELISA Kit
RD-SIRT5-Hu-96Tests 96 Tests

Human Sirtuin 5 (SIRT5) ELISA Kit

Sign In for Pricing
View Details
Bovine CYCS/CYC Antibody
E55A06707 100 µg

Bovine CYCS/CYC Antibody

Sign In for Pricing
View Details
Inseet Box
4030600/A 1 Each

Inseet Box

Sign In for Pricing
View Details