Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnaporthe oryzae Protein GET1 (GET1)

This Recombinant Magnaporthe oryzae Protein GET1 (GET1) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Protein GET1, Guided entry of tail-anchored proteins 1

UniProt

A4RHX3

Expression Region

1-215

Origin

Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSLLILIFTIEVAVELINTIGAATINNLLWRIFNALPTKLSAQFAEQRKLQQDYLKVRR ELNATSSQDEFAKWAKLRRQHDKLLEQLEKKKAALDSTKGNFDKYITGIRWVGTQGLRYF LPFWYAKVPMFWLPYGWFPYYAEWLVSFPRAPMGSVSIASWQLACTGFVVLIKDAITALV VFVMGMRQSNVKQAVPVKAVSGEKASDEKEGKKEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFYA siRNA (Mouse)
MBS8235058-01 15 nmol

NFYA siRNA (Mouse)

Sign In for Pricing
View Details
NFYA siRNA (Mouse)
MBS8235058-02 30 nmol

NFYA siRNA (Mouse)

Sign In for Pricing
View Details
NFYA siRNA (Mouse)
MBS8235058-03 5x 30 nmol

NFYA siRNA (Mouse)

Sign In for Pricing
View Details
Mouse CTDSP2 siRNA
abx913077-01 15 nmol

Mouse CTDSP2 siRNA

Sign In for Pricing
View Details
Mouse CTDSP2 siRNA
abx913077-02 30 nmol

Mouse CTDSP2 siRNA

Sign In for Pricing
View Details
Human anti-human fibrillarin IgG
A11C80 1 Each

Human anti-human fibrillarin IgG

Sign In for Pricing
View Details