Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnaporthe oryzae Protein GET1 (GET1)

This Recombinant Magnaporthe oryzae Protein GET1 (GET1) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Protein GET1, Guided entry of tail-anchored proteins 1

UniProt

A4RHX3

Expression Region

1-215

Origin

Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSLLILIFTIEVAVELINTIGAATINNLLWRIFNALPTKLSAQFAEQRKLQQDYLKVRR ELNATSSQDEFAKWAKLRRQHDKLLEQLEKKKAALDSTKGNFDKYITGIRWVGTQGLRYF LPFWYAKVPMFWLPYGWFPYYAEWLVSFPRAPMGSVSIASWQLACTGFVVLIKDAITALV VFVMGMRQSNVKQAVPVKAVSGEKASDEKEGKKEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2A13 Polyclonal Antibody
E20-71203 100 µg

CYP2A13 Polyclonal Antibody

Sign In for Pricing
View Details
RNFT1, NT (RNFT1, RING finger and transmembrane domain-containing protein 1, Protein PTD016) (Azide free) (HRP) discontinued
041154-HRP 200 µL

RNFT1, NT (RNFT1, RING finger and transmembrane domain-containing protein 1, Protein PTD016) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
WIPF2 Antibody (C-term) Blocking peptide
MBS9218021-01 0.5 mg

WIPF2 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
WIPF2 Antibody (C-term) Blocking peptide
MBS9218021-02 5x 0.5 mg

WIPF2 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
ROD1 (C-1) Alexa Fluor® 594
sc-398105 AF594 200 µg/mL

ROD1 (C-1) Alexa Fluor® 594

Sign In for Pricing
View Details
Melanoma; Pan (Concentrate)
A00134-C 1 mL

Melanoma; Pan (Concentrate)

Sign In for Pricing
View Details