Recombinant Magnaporthe oryzae Protein GET1 (GET1)
This Recombinant Magnaporthe oryzae Protein GET1 (GET1) spans the amino acid sequence from region 1-215.
Product Specifications
Product Name Alternative
Protein GET1, Guided entry of tail-anchored proteins 1
UniProt
A4RHX3
Expression Region
1-215
Origin
Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPSLLILIFTIEVAVELINTIGAATINNLLWRIFNALPTKLSAQFAEQRKLQQDYLKVRR ELNATSSQDEFAKWAKLRRQHDKLLEQLEKKKAALDSTKGNFDKYITGIRWVGTQGLRYF LPFWYAKVPMFWLPYGWFPYYAEWLVSFPRAPMGSVSIASWQLACTGFVVLIKDAITALV VFVMGMRQSNVKQAVPVKAVSGEKASDEKEGKKEL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-42310R-BF555 100 µL
Glutamine synthetase Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
Sign In for Pricing
View Details 
MBS6492267-01 0.1 mL
Pax6 (Paired Box Gene 6 (Aniridia, Keratitis), Paired Box Homeotic Gene 6, Paired Box Protein Pax-6, Pax-6, Aniridia Type II Protein, AN2, AN, D11S812E, MGC17209, MGDA, Oculorhombin, WAGR) (MaxLight 650)
Sign In for Pricing
View Details MBS6492267-02 5x 0.1 mL
Pax6 (Paired Box Gene 6 (Aniridia, Keratitis), Paired Box Homeotic Gene 6, Paired Box Protein Pax-6, Pax-6, Aniridia Type II Protein, AN2, AN, D11S812E, MGC17209, MGDA, Oculorhombin, WAGR) (MaxLight 650)
Sign In for Pricing
View Details