Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)
This Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 36, mitochondrial (AIM36) spans the amino acid sequence from region 41-255.
Product Specifications
Product Name Alternative
Altered inheritance of mitochondria protein 36, mitochondrial, Found in mitochondria protein 39
UniProt
B5VPS9
Expression Region
41-255
Origin
Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
SSTDSSTKRSNKSDKIDAPGFKKIFLVAIIGTVIFVKTVQSLDKNKPKTTLSEEEFENVV KGLKRRVAIFPQGEVDIKFSLSPSIEETRKVLQKSQGDDINELQFVDPVKVIDYYRTLRD DRYEALLNEYYKKYGCDTYAYNLPTGMLVMLLGRYFKENFKAGDKLVVVNFPHSIADATR FENEVSIVSKIFVPRKLSGSDVCKYYETVGKADII
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470525-100 1x 100 µL
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details