Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

This Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 36, mitochondrial (AIM36) spans the amino acid sequence from region 41-255.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 36, mitochondrial, Found in mitochondria protein 39

UniProt

C7GQ96

Expression Region

41-255

Origin

Saccharomyces cerevisiae (strain JAY291) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSTDSSTKRSNKSDKIDAPGFKKIFLVAIIGTVIFVKTVQSLDKNKPKTTLSEEEFENVV KGLKRRVAIFPQGEVDIKFSLSPSIEETRKVLQKSQGDDINELQFVDPVKVIDYYRTLRD DRYEALLNEYYKKYGCDTYAYNLPTGMLVMLLGRYFKENFKAGDKLVVVNFPHSIADATR FENEVSIVSKIFVPRKLSGSDVCKYYETVGKADII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-100 1x 100 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-100 1x 100 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-100 1x 100 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (MSN/493), CF568 conjugate, 0.1mg/mL
BNC680493-100 1x 100 µL

Moesin (MSN/493), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 (TRIM29/1042), CF740 conjugate, 0.1mg/mL
BNC741042-500 1x 500 µL

TRIM29 (TRIM29/1042), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF594 conjugate, 0.1mg/mL
BNC941986-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details