Recombinant Saccharomyces cerevisiae Vacuolar ATPase assembly integral membrane protein VPH2 (VPH2)
This Recombinant Saccharomyces cerevisiae Vacuolar ATPase assembly integral membrane protein VPH2 (VPH2) spans the amino acid sequence from region 1-215.
Product Specifications
Product Name Alternative
Vacuolar ATPase assembly integral membrane protein VPH2, Protein VMA12
UniProt
P32341
Expression Region
1-215
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFEIKLNDRITEFLRKFKNSAKSNEGIDEDIDLFLKRHAIPMQSLLFYVKEYRKDSDLQC SIKELLKPLEFEFKPKAVRGLHYSEDFKKKLEFLKYQEQELEYQSMVKRSKSVFSLQEDD ELTPSQINKQIKEQVTTVFNVLVSVISVVVAIWYWTGSSTNFPVHVRLLLCLFFGILVLV ADVVVYNSYLKKLEEAKVKEKTKVEKKKVLSKITL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400525-100 1x 100 µL
CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details