Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Sigma-E factor negative regulatory protein (rseA)

This Recombinant Escherichia coli Sigma-E factor negative regulatory protein (rseA) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Sigma-E factor negative regulatory protein

UniProt

P0AFX7

Expression Region

1-216

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVM AAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQH YNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDY ELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP2C2 Protein Vector (Human) (pPM-N-D-C-HA)
PV325040 500 ng

ATP2C2 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Anti-Calgizzarin S100A11 Antibody
A03168-1 100 µL

Anti-Calgizzarin S100A11 Antibody

Sign In for Pricing
View Details
CEP68 Polyclonal Antibody
E44H08183 100 µL

CEP68 Polyclonal Antibody

Sign In for Pricing
View Details
Tumor Necrosis Factor Related Apoptosis-inducing ligand 3 (TRAIL-R3) Rabbit ELISA Kit
80198 96 Tests

Tumor Necrosis Factor Related Apoptosis-inducing ligand 3 (TRAIL-R3) Rabbit ELISA Kit

Sign In for Pricing
View Details
MeCP2 (S421) (MECP2, Methyl-CpG-binding protein 2) (MaxLight 405) discontinued
038309-ML405 100 µL

MeCP2 (S421) (MECP2, Methyl-CpG-binding protein 2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Copper Wire, Bare
2021121/6 1 Each

Copper Wire, Bare

Sign In for Pricing
View Details