Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sigma-E factor negative regulatory protein (rseA)

This Recombinant Sigma-E factor negative regulatory protein (rseA) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Sigma-E factor negative regulatory protein

UniProt

P0AFX8

Expression Region

1-216

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVM AAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQH YNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDY ELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRP9 Rabbit pAb
E45R23816N-50 50 µL

RRP9 Rabbit pAb

Sign In for Pricing
View Details
Cyp4a14 Mouse siRNA Oligo Duplex (Locus ID 13119)
SR416294 1 Kit

Cyp4a14 Mouse siRNA Oligo Duplex (Locus ID 13119)

Sign In for Pricing
View Details
Mouse Ferritin heavy chain, FTH1 ELISA KIT
E0920Mo-01 48 Well

Mouse Ferritin heavy chain, FTH1 ELISA KIT

Sign In for Pricing
View Details
Mouse Ferritin heavy chain, FTH1 ELISA KIT
E0920Mo-02 96 Well

Mouse Ferritin heavy chain, FTH1 ELISA KIT

Sign In for Pricing
View Details
Mouse Ferritin heavy chain, FTH1 ELISA KIT
E0920Mo-03 5x 96 Tests

Mouse Ferritin heavy chain, FTH1 ELISA KIT

Sign In for Pricing
View Details
Mouse Ferritin heavy chain, FTH1 ELISA KIT
E0920Mo-04 10x 96 Tests

Mouse Ferritin heavy chain, FTH1 ELISA KIT

Sign In for Pricing
View Details