Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sigma-E factor negative regulatory protein (rseA)

This Recombinant Sigma-E factor negative regulatory protein (rseA) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Sigma-E factor negative regulatory protein

UniProt

P0AFX8

Expression Region

1-216

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVM AAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQH YNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDY ELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Msantd3 (NM_001145925) Mouse Recombinant Protein
E45M47684M5 20 µg

Msantd3 (NM_001145925) Mouse Recombinant Protein

Sign In for Pricing
View Details
MED19/LCMR1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-18765R-APC-Cy7 100 µL

MED19/LCMR1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Human Apolipoprotein M Recombinant Protein C-6 His Tag Lyophilized
MBS8431239-01 0.05 mg

Human Apolipoprotein M Recombinant Protein C-6 His Tag Lyophilized

Sign In for Pricing
View Details
Human Apolipoprotein M Recombinant Protein C-6 His Tag Lyophilized
MBS8431239-02 5x 0.05 mg

Human Apolipoprotein M Recombinant Protein C-6 His Tag Lyophilized

Sign In for Pricing
View Details
JNJ-26146900
MBS5777380 Inquire

JNJ-26146900

Sign In for Pricing
View Details
Dnajb1 Antibody
GWB-MT551B 50 µg

Dnajb1 Antibody

Sign In for Pricing
View Details