Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sigma-E factor negative regulatory protein (rseA)

This Recombinant Sigma-E factor negative regulatory protein (rseA) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Sigma-E factor negative regulatory protein

UniProt

P0AFX8

Expression Region

1-216

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVM AAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQH YNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDY ELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRN1 Antibody, FITC conjugated
A58500-100UG 100 µg

LRRN1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Masson Stain Kit, 1 pack = 700 mL
BAL509 1 Pack

Masson Stain Kit, 1 pack = 700 mL

Sign In for Pricing
View Details
PTPψ (E-2) : m-IgG Fc BP-HRP Bundle
sc-527668 1 Kit

PTPψ (E-2) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Fcrla Mouse Pre-designed siRNA Set A
HY-RS20925 1 Set

Fcrla Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
ELISA Kit for Prostate Specific Antigen (PSA)
TRV-0037820-01 24 Tests

ELISA Kit for Prostate Specific Antigen (PSA)

Sign In for Pricing
View Details
ELISA Kit for Prostate Specific Antigen (PSA)
TRV-0037820-02 48 Tests

ELISA Kit for Prostate Specific Antigen (PSA)

Sign In for Pricing
View Details