Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C7orf13 (C7orf13)

This Recombinant Human Uncharacterized protein C7orf13 (C7orf13) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Uncharacterized protein C7orf13

UniProt

Q8NI28

Expression Region

1-216

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLASPARPTLRMLANHALSTPHCACSPAPAPRTASASRRRCVPVEARAAGVFGDRLAGVF GSRGLKHGGVQAPRPRVVRAEPRAGFAVVRSPRRLCGRSHAPQPPAHLGLGPGCFPAVAV VVPVPGSRAHRPFAALLVEGSFLGDPPIPPRRSGVLARGSAGADCLASSVTPGPSLWIPL LLVAGCVSCFVGLAVCVWMQARVSPAWPAGLFLLPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Di-tert-butyl-6-(5-chloro-2H-benzotriazol-2-yl)phenol-d20
TRC-D428017-5MG 5 mg

2,4-Di-tert-butyl-6-(5-chloro-2H-benzotriazol-2-yl)phenol-d20

Sign In for Pricing
View Details
RYBP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B2]
TA504650BM 100 µL

RYBP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B2]

Sign In for Pricing
View Details
IGFBP3 (NM_001013398) Human Over-expression Lysate
LY422966 100 µg

IGFBP3 (NM_001013398) Human Over-expression Lysate

Sign In for Pricing
View Details
Sulfathiazol-KLH Conjugate
50030-AAT 1 mg

Sulfathiazol-KLH Conjugate

Sign In for Pricing
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: SPM150]
AM50175PU-T 20 µg

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone ID: SPM150]

Sign In for Pricing
View Details
Mouse ACV-A Antibody Pair Set
E-KAB-0648 50 µL & 100 µg

Mouse ACV-A Antibody Pair Set

Sign In for Pricing
View Details