Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Membrane-associated progesterone receptor component 2 (Pgrmc2)

This Recombinant Mouse Membrane-associated progesterone receptor component 2 (Pgrmc2) spans the amino acid sequence from region 1-217.

Product Specifications

Product Name Alternative

Membrane-associated progesterone receptor component 2

UniProt

Q80UU9

Expression Region

1-217

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGDGDVKLSTLGSGGESGGDGSPGGAGATAARSSWVAALLATGGEMLLNVALVALVLL GAYRLWVRWGRRGLCSGPGAGEESPAATLPRMKKRDFSLEQLRQYDGARTPRILLAVNGK VFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREW EMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHSKQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ku 70 Conjugated Antibody
C49508 100 µL

Ku 70 Conjugated Antibody

Sign In for Pricing
View Details
(4-Bromo-2-nitrophenyl) acetic acid 98+% (HPLC)
232940-01 250 mg

(4-Bromo-2-nitrophenyl) acetic acid 98+% (HPLC)

Sign In for Pricing
View Details
(4-Bromo-2-nitrophenyl) acetic acid 98+% (HPLC)
232940-02 1 g

(4-Bromo-2-nitrophenyl) acetic acid 98+% (HPLC)

Sign In for Pricing
View Details
(4-Bromo-2-nitrophenyl) acetic acid 98+% (HPLC)
232940-03 5 g

(4-Bromo-2-nitrophenyl) acetic acid 98+% (HPLC)

Sign In for Pricing
View Details
(4-Bromo-2-nitrophenyl) acetic acid 98+% (HPLC)
232940-04 25 g

(4-Bromo-2-nitrophenyl) acetic acid 98+% (HPLC)

Sign In for Pricing
View Details
CPLX1 Antibody (Biotin)
orb23389-01 50 µg

CPLX1 Antibody (Biotin)

Sign In for Pricing
View Details