Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse TM2 domain-containing protein 3 (Tm2d3)

This Recombinant Mouse TM2 domain-containing protein 3 (Tm2d3) spans the amino acid sequence from region 45-261.

Product Specifications

Product Name Alternative

TM2 domain-containing protein 3

UniProt

Q8BJ83

Expression Region

45-261

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IKDPGPTRTFSVVPRAAENQLFSHLTESTEIPPYMTKCPSNGLCSRLPADCIECATNVSC TYGKPVTFDCTVKPSVTCVDQDLKPQRNFVINMTCRFCWQLPETDYECSNSTTCMTVACP RQRYFANCTVRDHIHCLGNRTFPKLLYCNWTGGYKWSTALALSITLGGFGADRFYLGQWR EGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EVL (Ena/VASP-like Protein, Ena/Vasodilator-stimulated Phosphoprotein-like, RNB6) (MaxLight 750)
MBS6232751-01 0.1 mL

EVL (Ena/VASP-like Protein, Ena/Vasodilator-stimulated Phosphoprotein-like, RNB6) (MaxLight 750)

Sign In for Pricing
View Details
EVL (Ena/VASP-like Protein, Ena/Vasodilator-stimulated Phosphoprotein-like, RNB6) (MaxLight 750)
MBS6232751-02 5x 0.1 mL

EVL (Ena/VASP-like Protein, Ena/Vasodilator-stimulated Phosphoprotein-like, RNB6) (MaxLight 750)

Sign In for Pricing
View Details
Human Aryl Hydrocarbon Receptor (AHR) ELISA Kit
abx053431 96 Well

Human Aryl Hydrocarbon Receptor (AHR) ELISA Kit

Sign In for Pricing
View Details
Interleukin-5
AP84212 1 mg

Interleukin-5

Sign In for Pricing
View Details
Anti-Human FABP4/aP2 Antibody (CA33)
HB171013-01 50 µg

Anti-Human FABP4/aP2 Antibody (CA33)

Sign In for Pricing
View Details
Anti-Human FABP4/aP2 Antibody (CA33)
HB171013-02 100 µg

Anti-Human FABP4/aP2 Antibody (CA33)

Sign In for Pricing
View Details