Recombinant Rhodobacter capsulatus Electron transport complex protein RnfG (rnfG)
This Recombinant Rhodobacter capsulatus Electron transport complex protein RnfG (rnfG) spans the amino acid sequence from region 1-217.
Product Specifications
Product Name Alternative
Electron transport complex protein RnfG, Nitrogen fixation protein RnfG
UniProt
P97054
Expression Region
1-217
Origin
Rhodobacter capsulatus (Rhodopseudomonas capsulata)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTDTPPPEKPKLPWFKASPLAHGIMLAMFALVTAVLLAVANDSTSAPIAARGAEDLAASL EQVIPHDLHDNDLAAAMRPVSDAEEGTIKVYVATKAGAVTGLAYELSGPGYSGQIRVLLG IAPDGTLLGVRVLSHTETPGLGDKIEVAKDDWILGFAGKSLADPEPGHWKVKRDGGVFDQ FSGATITPRAVVKTIYRGLMFFDRNKAALTAPLPPKS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681037-500 1x 500 µL
CD44 Standard (DF1485), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940525-100 1x 100 µL
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472552-100 1x 100 µL
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940689-500 1x 500 µL
Cytokeratin 8 (K8.8), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details