Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Coiled-coil domain-containing protein 107 (Ccdc107)

This Recombinant Mouse Coiled-coil domain-containing protein 107 (Ccdc107) spans the amino acid sequence from region 25-242.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 107

UniProt

Q9DCC3

Expression Region

25-242

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ERPSADLGAHPERGSQVSPGTTEPRRQPPPKDQRERARAGSLSLGALYTAAVVAFVLFKC LQGPDEAAVLREEKNKKKSSQSEQQLVQLTQQLAQTEQHLNHLMTQLDPLFEQVTTLVGT QRELLDTKLKTIHHLLQDCQPGTGVEVPEPEASIPFTEDLGKEDQEAGNSQAWEEPITWS PETRNLAPSWEVEQGLRRRWHKTVTKGPAVNGEQPLKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ac-LKKR-AMC
13446-AAT 1 mg

Ac-LKKR-AMC

Sign In for Pricing
View Details
Factor XIII (F13B) Human Gene Knockout Kit (CRISPR)
KN419609 1 Kit

Factor XIII (F13B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-[[4-[(1E)-2-[4-[[2-(2,5-Dihydro-2,5-dioxo-1H-pyrrol-1-yl)acetyl]amino]phenyl]diazenyl]phenyl]amino]-N,N,N-triethyl-2-oxoethanaminium Chloride
TRC-D450375-2.5MG 2.5 mg

2-[[4-[(1E)-2-[4-[[2-(2,5-Dihydro-2,5-dioxo-1H-pyrrol-1-yl)acetyl]amino]phenyl]diazenyl]phenyl]amino]-N,N,N-triethyl-2-oxoethanaminium Chloride

Sign In for Pricing
View Details
Climatic Chamber BCCL-1403
BCCL-1403 1 Unit

Climatic Chamber BCCL-1403

Sign In for Pricing
View Details
NPSR1 Human Gene Knockout Kit (CRISPR)
KN220736 1 Kit

NPSR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR561080 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details