Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU4 Membrane protein (M)

This Recombinant Bat coronavirus HKU4 Membrane protein (M) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

A3EXA0

Expression Region

1-219

Origin

Bat coronavirus HKU4 (BtCoV) (BtCoV/HKU4/2004)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS MALSIFSAIYPISLSSQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLN VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM VKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
BNC400177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-100 1x 100 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF568 conjugate, 0.1mg/mL
BNC680512-100 1x 100 µL

CD68 (KP1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1148), CF405S conjugate, 0.1mg/mL
BNC041148-100 1x 100 µL

CD45RA (PTPRC/1148), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (4C4.9), CF640R conjugate, 0.1mg/mL
BNC400143-500 1x 500 µL

S100B (4C4.9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details