Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfG (rnfG)

This Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfG (rnfG) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfG, Nitrogen fixation protein RnfG

UniProt

A3PRP7

Expression Region

1-219

Origin

Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDDTAAPPPRGPARDWKSSPLVSGLLLGLFSLVSALMLALASDATRGPIAARSAEDLLA SLAQVLPAALHDNDPTADIRTLADADEGAVRVYVATRGGAVTAVTFELTGYGYGGAIRVL MAVAADGTILGARVLSHTETPGLGDKIEIGKDDWIEGFAGRSLTDPGPAGWKVRRDGGVF DQFSGATITPRAVVGTIHRGLTLFDRHRAELLAPLPLRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS701083 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human TEX55 activation kit by CRISPRa
GA115833 1 Kit

Human TEX55 activation kit by CRISPRa

Sign In for Pricing
View Details
Pure Ulex europaeus Lectin (GorseFurze) -UEA-II-
L-2202-2 2 mg

Pure Ulex europaeus Lectin (GorseFurze) -UEA-II-

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS714569 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF647 conjugate, 0.1mg/mL
BNC471761-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NEDD4 2 (NEDD4L) (NM_001144964) Human Over-expression Lysate
LC428611 20 µg

NEDD4 2 (NEDD4L) (NM_001144964) Human Over-expression Lysate

Sign In for Pricing
View Details