Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfG (rnfG)

This Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfG (rnfG) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfG, Nitrogen fixation protein RnfG

UniProt

A3PRP7

Expression Region

1-219

Origin

Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDDTAAPPPRGPARDWKSSPLVSGLLLGLFSLVSALMLALASDATRGPIAARSAEDLLA SLAQVLPAALHDNDPTADIRTLADADEGAVRVYVATRGGAVTAVTFELTGYGYGGAIRVL MAVAADGTILGARVLSHTETPGLGDKIEIGKDDWIEGFAGRSLTDPGPAGWKVRRDGGVF DQFSGATITPRAVVGTIHRGLTLFDRHRAELLAPLPLRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Idebenone
SIH-150-100MG 100 mg

Idebenone

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/2092R), 0.2mg/mL
BNUB2092-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/2092R), 0.2mg/mL

Sign In for Pricing
View Details
2-Propylhexanoic Acid
TRC-P837100-25MG 25 mg

2-Propylhexanoic Acid

Sign In for Pricing
View Details
MCG10 (PCBP4) Human Gene Knockout Kit (CRISPR)
KN400749 1 Kit

MCG10 (PCBP4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(S)-3-Amino-6,7-dihydroxy-hydrocoumarin Hydrochloride
TRC-A605095-25MG 25 mg

(S)-3-Amino-6,7-dihydroxy-hydrocoumarin Hydrochloride

Sign In for Pricing
View Details
RAB18 (NM_021252) Human Over-expression Lysate
LC402861 20 µg

RAB18 (NM_021252) Human Over-expression Lysate

Sign In for Pricing
View Details