Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfG (rnfG)

This Recombinant Rhodobacter sphaeroides Electron transport complex protein RnfG (rnfG) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfG, Nitrogen fixation protein RnfG

UniProt

Q3IXC2

Expression Region

1-219

Origin

Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDDTAAPPPRGPARDWKSSPLVSGLLLGLFSLVSALMLALASDATRGPIAARSAEDLLA SLAQVLPETLHDNDPTADIRTLSDADEGAVRVYVAARGGAVTAVTFELTGYGYGGAIRVL MAVAADGTILGARVLSHTETPGLGDKIEIGKDDWIEGFAGRSLTDPGPAGWKVRRDGGVF DQFSGATITPRAVVGTIHRGLTLFDRHRAELLAPLPPRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sirp alpha1 discontinued
334328 100 µL

Sirp alpha1 discontinued

Sign In for Pricing
View Details
PROC Recombinant Antibody, PE-Cy5 Conjugated
bsm-61592R-PE-Cy5-01 20 µL

PROC Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
PROC Recombinant Antibody, PE-Cy5 Conjugated
bsm-61592R-PE-Cy5-02 100 µL

PROC Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Eriodictyol 7-O-β-D-glucuronide ethyl ester
orb1681209 5 mg

Eriodictyol 7-O-β-D-glucuronide ethyl ester

Sign In for Pricing
View Details
Phospho-Met (c-Met) (Y1349) (9V17) Rabbit Monoclonal Antibody
E28M6230 100 µL

Phospho-Met (c-Met) (Y1349) (9V17) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CAV2, NT (Caveolin-2) (MaxLight 750)
MBS6467772-01 0.1 mL

CAV2, NT (Caveolin-2) (MaxLight 750)

Sign In for Pricing
View Details