Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

This Recombinant Ustilago maydis Mitochondrial intermembrane space import and assembly protein 40 (MIA40) spans the amino acid sequence from region 29-247.

Product Specifications

Product Name Alternative

Mitochondrial intermembrane space import and assembly protein 40, Mitochondrial import inner membrane translocase TIM40

UniProt

Q4P8D2

Expression Region

29-247

Origin

Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VATKAAAGPSRQSALSSYSIAAVTAIGVGASFYALQSRSSAIQCEPRQAWHDRLKPKEAK GDATLHKDAHTRHAPAEVQDERVEPVEETPVAIEVAVEESEEQTGQQSAYDPETGEINWD CPCLGGMAHGPCGEQFKLAFSCFVYSEAEPKGIDCVDKFKAMQDCFREHPDVYKDEIEDD EAANAQFEKEEANAKSNGLNDAAQEAVEESSGGKEGASA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-100 1x 100 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-500 1x 500 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (3H9), CF555 conjugate, 0.1mg/mL
BNC550242-500 1x 500 µL

PTH / Parathyroid Hormone (N-Terminal) (3H9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Laminin (A5), CF640R conjugate, 0.1mg/mL
BNC400308-100 1x 100 µL

Laminin (A5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), 0.2mg/mL
BNUB0158-100 1x 100 µL

Cytokeratin 17 (E3), 0.2mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF405S conjugate, 0.1mg/mL
BNC042375-500 1x 500 µL

Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details