Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L631 (MIMI_L631)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L631 (MIMI_L631) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Uncharacterized protein L631

UniProt

Q5UR77

Expression Region

1-219

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKNNSKSTQGAPLDYIPGITTINQPVFMDDSVLTMNPTMNVPTTNTLISPIPVTTSKSS QLDSAHPTVVHIGDNHPEPKNESKTQPKIESKKEPTLKQEEQTIQAEEEAQKIAKEETRE SFLRYGGEIIIDIMLGILLGIAVNMLTDYIASIFGLKGTAKFPIQLVLIVIVLYMLRINP DISFPLRSRTDTYGVIFIPIFITAQRNFAIFFSELYNIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Doublecortin (DCX) (NM_178151) Human Recombinant Protein
TP316349L 1 mg

Doublecortin (DCX) (NM_178151) Human Recombinant Protein

Sign In for Pricing
View Details
RAI2 (NM_001172732) Human Over-expression Lysate
LC433148 20 µg

RAI2 (NM_001172732) Human Over-expression Lysate

Sign In for Pricing
View Details
Thiabendazole-d4 (Major)
TRC-T344152-1MG 1 mg

Thiabendazole-d4 (Major)

Sign In for Pricing
View Details
Strn Mouse Gene Knockout Kit (CRISPR)
KN516914 1 Kit

Strn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS707064 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
TTC10 (IFT88) Human Knockdown Lysate
LY300207 100 µg

TTC10 (IFT88) Human Knockdown Lysate

Sign In for Pricing
View Details