Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma hominis Protein LemA (lemA)

This Recombinant Mycoplasma hominis Protein LemA (lemA) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Protein LemA, ORF219

UniProt

P43054

Expression Region

1-219

Origin

Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFDSRTPQSSEGFKPNVDNSIKKPIPTGVEKFFFILFFILTIGIFYFVYVGRKNELMRD QNEIQNASSLIQAAEKRRRAVLIKMMDSLIGYKNFENETLSKITQYRSKLSNIDVDKTSP VELKSQIDSIRGALNFQFEQYPDLKASKLYLQFSTEISMQEDEIYATIRNYNMIATSFNS KIYTFWTNCVAQKLDLYNVAIFQASEIERVDVDTSELRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-500 1x 500 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-100 1x 100 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-500 1x 500 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-500 1x 500 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-500 1x 500 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details