Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU9 Non-structural protein 3 (3)

This Recombinant Bat coronavirus HKU9 Non-structural protein 3 (3) spans the amino acid sequence from region 1-220.

Product Specifications

Product Name Alternative

Non-structural protein 3, ns3, Accessory protein 3

UniProt

A3EXG7

Expression Region

1-220

Origin

Bat coronavirus HKU9 (BtCoV) (BtCoV/HKU9)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLYNLVRDALRPSYATVSPSVDEPTVDNNFVALSCYATLSVLLYYLQRVKQPYLSMLFH ILFCLSQVCMVIWLIFSANFYVSLFAQCMLVVCALGCFLERTILSIKLRSMAPFMSMADN FAIIKTTCNNYVFPVERSSDNLVVLTTSRGIYSNGVFMKGAITVSDNALVVSLFKSHSLL LDRVEHGYDYTVFIYINSVILQNIKPTVSVVNTEFTDVEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

galectin 9 (LGALS9) Human Gene Knockout Kit (CRISPR)
KN210750RB 1 Kit

galectin 9 (LGALS9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rotundine
TRC-R700760-25MG 25 mg

Rotundine

Sign In for Pricing
View Details
Human NUP210L activation kit by CRISPRa
GA114094 1 Kit

Human NUP210L activation kit by CRISPRa

Sign In for Pricing
View Details
ERG (NM_182918) Human Over-expression Lysate
LY403650 100 µg

ERG (NM_182918) Human Over-expression Lysate

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF405S conjugate, 0.1mg/mL
BNC040923-500 1x 500 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TUBB6 (Center) Rabbit Polyclonal Antibody
AP54418PU-N 400 µL

TUBB6 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details